Lineage for d2d04a_ (2d04 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806095Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 1806096Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. 1806148Family b.78.1.0: automated matches [191418] (1 protein)
    not a true family
  6. 1806149Protein automated matches [190587] (7 species)
    not a true protein
  7. 1806160Species Curculigo latifolia [TaxId:4676] [187595] (2 PDB entries)
  8. 1806165Domain d2d04a_: 2d04 A: [163518]
    automated match to d1npla_
    complexed with nag

Details for d2d04a_

PDB Entry: 2d04 (more details), 2.76 Å

PDB Description: crystal structure of neoculin, a sweet protein with taste-modifying activity.
PDB Compounds: (A:) neoculin acidic subunit

SCOPe Domain Sequences for d2d04a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d04a_ b.78.1.0 (A:) automated matches {Curculigo latifolia [TaxId: 4676]}
dsvllsgqtlyaghsltsgsytltiqnncnlvkyqhgrqiwasdtdgqgsqcrltlrsdg
nliiyddnnmvvwgsdcwgnngtyalvlqqdglfviygpvlwplglngcrs

SCOPe Domain Coordinates for d2d04a_:

Click to download the PDB-style file with coordinates for d2d04a_.
(The format of our PDB-style files is described here.)

Timeline for d2d04a_: