SCOPe 2.01: Domain d2d02a_: 2d02 A:

Lineage for d2d02a_ (2d02 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (47 PDB entries)
   Uniprot P16113

8. Domain d2d02a_: 2d02 A: [163517]
   automated match to d1nwza_
   complexed with hc4; mutant

Details for d2d02a_

PDB Entry: 2d02, 1.42 Å

PDB Description: r52q mutant of photoactive yellow protein, p65 form

PDB Compounds: (A:) Photoactive yellow protein

SCOPe Domain Sequences for d2d02a_:

Sequence; same for both SEQRES and ATOM records:

>d2d02a_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgqdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

Timeline for d2d02a_:

• d2d02a_ is new in SCOPe 2.01-stable
  
• d2d02a_ appears in SCOPe 2.02
  
• d2d02a_ appears in the current release, SCOPe 2.08