SCOPe 2.02: Domain d2cyxc_: 2cyx C:

Lineage for d2cyxc_ (2cyx C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (19 PDB entries)

8. Domain d2cyxc_: 2cyx C: [163516]
   automated match to d2ucza_

Details for d2cyxc_

PDB Entry: 2cyx, 2.56 Å

PDB Description: structure of human ubiquitin-conjugating enzyme e2 g2 (ube2g2/ubc7)

PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 G2

SCOPe Domain Sequences for d2cyxc_:

Sequence; same for both SEQRES and ATOM records:

>d2cyxc_ d.20.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsefmagtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpa
ilsfpldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsv
ekillsvvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl

Timeline for d2cyxc_:

• d2cyxc_ first appeared in SCOPe 2.01
  
• d2cyxc_ appears in SCOPe 2.03
  
• d2cyxc_ appears in the current release, SCOPe 2.08, called d2cyxc1