SCOPe 2.08: Domain d2cyxc1: 2cyx C:1-165

Lineage for d2cyxc1 (2cyx C:1-165)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries)

8. Domain d2cyxc1: 2cyx C:1-165 [163516]
   Other proteins in same PDB: d2cyxa2, d2cyxb2, d2cyxc2
   automated match to d2ucza_

Details for d2cyxc1

PDB Entry: 2cyx, 2.56 Å

PDB Description: structure of human ubiquitin-conjugating enzyme e2 g2 (ube2g2/ubc7)

PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 G2

SCOPe Domain Sequences for d2cyxc1:

Sequence; same for both SEQRES and ATOM records:

>d2cyxc1 d.20.1.1 (C:1-165) automated matches {Human (Homo sapiens) [TaxId: 9606]}
magtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpailsf
pldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsvekil
lsvvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl

Timeline for d2cyxc1:

• d2cyxc1 first appeared in SCOPe 2.01, called d2cyxc_
  
• d2cyxc1 appears in SCOPe 2.07