Lineage for d2cyxb_ (2cyx B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1198735Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1198736Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1198737Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1198890Protein automated matches [190124] (11 species)
    not a true protein
  7. 1198898Species Human (Homo sapiens) [TaxId:9606] [186848] (19 PDB entries)
  8. 1198932Domain d2cyxb_: 2cyx B: [163515]
    automated match to d2ucza_

Details for d2cyxb_

PDB Entry: 2cyx (more details), 2.56 Å

PDB Description: structure of human ubiquitin-conjugating enzyme e2 g2 (ube2g2/ubc7)
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 G2

SCOPe Domain Sequences for d2cyxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cyxb_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsefmagtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpa
ilsfpldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsv
ekillsvvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl

SCOPe Domain Coordinates for d2cyxb_:

Click to download the PDB-style file with coordinates for d2cyxb_.
(The format of our PDB-style files is described here.)

Timeline for d2cyxb_: