Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein automated matches [190124] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186848] (14 PDB entries) |
Domain d2cyxa_: 2cyx A: [163514] automated match to d2ucza_ |
PDB Entry: 2cyx (more details), 2.56 Å
SCOPe Domain Sequences for d2cyxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cyxa_ d.20.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gsefmagtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpa ilsfpldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsv ekillsvvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl
Timeline for d2cyxa_: