Lineage for d2cyfc_ (2cyf C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373041Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2373586Protein automated matches [190035] (28 species)
    not a true protein
  7. 2373682Species Canavalia maritima [TaxId:3825] [187574] (6 PDB entries)
  8. 2373695Domain d2cyfc_: 2cyf C: [163513]
    automated match to d1apna_
    complexed with ca, mal, mn

Details for d2cyfc_

PDB Entry: 2cyf (more details), 1.8 Å

PDB Description: the crystal structure of canavalia maritima lectin (conm) in complex with trehalose and maltose
PDB Compounds: (C:) lectin

SCOPe Domain Sequences for d2cyfc_:

Sequence, based on SEQRES records: (download)

>d2cyfc_ b.29.1.1 (C:) automated matches {Canavalia maritima [TaxId: 3825]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d2cyfc_ b.29.1.1 (C:) automated matches {Canavalia maritima [TaxId: 3825]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklktnal
hfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwessa
vvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d2cyfc_:

Click to download the PDB-style file with coordinates for d2cyfc_.
(The format of our PDB-style files is described here.)

Timeline for d2cyfc_: