Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
Protein automated matches [190581] (8 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [187585] (1 PDB entry) |
Domain d2cybb_: 2cyb B: [163511] automated match to d1j1ua_ protein/RNA complex; complexed with tyr |
PDB Entry: 2cyb (more details), 1.8 Å
SCOPe Domain Sequences for d2cybb_:
Sequence, based on SEQRES records: (download)
>d2cybb_ c.26.1.1 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mditeklrlitrnaeevvteeelrqlietkekprayvgyepsgeihlghmmtvqklmdlq eagfeiivlladihaylnekgtfeeiaevadynkkvfialgldesrakfvlgseyqlsrd yvldvlkmarittlnrarrsmdevsrrkedpmvsqmiyplmqaldiahlgvdlavggidq rkihmlarenlprlgysspvclhtpilvgldgqkmssskgnyisvrdppeeverkirkay cpagvveenpildiakyhilprfgkivverdakfggdveyasfeelaedfksgqlhpldl kiavakylnmlledarkrlg
>d2cybb_ c.26.1.1 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mditeklrlitrnaeevvteeelrqlietkekprayvgyepsgeihlghmmtvqklmdlq eagfeiivlladihaylnekgtfeeiaevadynkkvfialgldesrakfvlgseyqlsrd yvldvlkmarittlnrarrsmdevsrrkedpmvsqmiyplmqaldiahlgvdlavggidq rkihmlarenlprlgysspvclhtpilvgldgqkmssskgnyisvrdppeeverkirkay cpagvveenpildiakyhilprfgkivverdagdveyasfeelaedfksgqlhpldlkia vakylnmlledarkrlg
Timeline for d2cybb_: