Lineage for d2cyba_ (2cyb A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841353Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1841582Protein automated matches [190581] (8 species)
    not a true protein
  7. 1841583Species Archaeoglobus fulgidus [TaxId:2234] [187585] (1 PDB entry)
  8. 1841584Domain d2cyba_: 2cyb A: [163510]
    automated match to d1j1ua_
    protein/RNA complex; complexed with tyr

Details for d2cyba_

PDB Entry: 2cyb (more details), 1.8 Å

PDB Description: Crystal structure of Tyrosyl-tRNA Synthetase complexed with L-tyrosine from Archaeoglobus fulgidus
PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d2cyba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cyba_ c.26.1.1 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
diteklrlitrnaeevvteeelrqlietkekprayvgyepsgeihlghmmtvqklmdlqe
agfeiivlladihaylnekgtfeeiaevadynkkvfialgldesrakfvlgseyqlsrdy
vldvlkmarittlnrarrsmdevsrrkedpmvsqmiyplmqaldiahlgvdlavggidqr
kihmlarenlprlgysspvclhtpilvgldgqkmssskgnyisvrdppeeverkirkayc
pagvveenpildiakyhilprfgkivverdakfggdveyasfeelaedfksgqlhpldlk
iavakylnmlledarkrlg

SCOPe Domain Coordinates for d2cyba_:

Click to download the PDB-style file with coordinates for d2cyba_.
(The format of our PDB-style files is described here.)

Timeline for d2cyba_: