Lineage for d1bdd__ (1bdd -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1903Fold a.8: Bacterial immunoglobulin/albumin-binding domains [46996] (1 superfamily)
  4. 1904Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) (S)
  5. 1905Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (1 protein)
  6. 1906Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 1907Species Staphylococcus aureus [TaxId:1280] [47000] (9 PDB entries)
  8. 1917Domain d1bdd__: 1bdd - [16351]

Details for d1bdd__

PDB Entry: 1bdd (more details)

PDB Description: staphylococcus aureus protein a, immunoglobulin-binding b domain, nmr, minimized average structure

SCOP Domain Sequences for d1bdd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdd__ a.8.1.1 (-) Immunoglobulin-binding protein A modules {Staphylococcus aureus}
tadnkfnkeqqnafyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapka

SCOP Domain Coordinates for d1bdd__:

Click to download the PDB-style file with coordinates for d1bdd__.
(The format of our PDB-style files is described here.)

Timeline for d1bdd__: