![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
![]() | Superfamily c.80.1: SIS domain [53697] (4 families) ![]() |
![]() | Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 proteins) permutation of the double-SIS domain fold automatically mapped to Pfam PF00342 |
![]() | Protein automated matches [190137] (6 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187571] (9 PDB entries) |
![]() | Domain d2cxrb_: 2cxr B: [163500] automated match to d1iria_ complexed with 6pg, gol |
PDB Entry: 2cxr (more details), 1.7 Å
SCOPe Domain Sequences for d2cxrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cxrb_ c.80.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} maaltrnpqfqkllewhransanlklrelfeadperfnnfslnlntnhghilvdysknlv skevmqmlvelaksrgveaardnmfsgskinytedravlhvalrnrsntpikvdgkdvmp evnrvldkmksfcqrvrsgdwkgytgksitdiinigiggsdlgplmvtealkpyskggpr vwfvsnidgthiaktlaslspetslfiiasktfttqetitnaetakewfleaakdpsava khfvalstntakvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdhfeqllsga hwmdqhflktpleknapvllallgiwyincygcethallpydqymhrfaayfqqgdmesn gkyitksgarvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkgl hhkillanflaqtealmkgklpeearkelqaagkspedlekllphkvfegnrptnsivft kltpfilgaliamyehkifvqgimwdinsfdqwgvelgkqlakkiepelegssavtshds stnglisfikqqrdtkl
Timeline for d2cxrb_: