Lineage for d1bdc__ (1bdc -)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211352Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (2 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 211353Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) (S)
  5. 211354Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (1 protein)
  6. 211355Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 211356Species Staphylococcus aureus [TaxId:1280] [47000] (9 PDB entries)
  8. 211365Domain d1bdc__: 1bdc - [16350]
    domain B

Details for d1bdc__

PDB Entry: 1bdc (more details)

PDB Description: staphylococcus aureus protein a, immunoglobulin-binding b domain, nmr, 10 structures

SCOP Domain Sequences for d1bdc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdc__ a.8.1.1 (-) Immunoglobulin-binding protein A modules {Staphylococcus aureus}
tadnkfnkeqqnafyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapka

SCOP Domain Coordinates for d1bdc__:

Click to download the PDB-style file with coordinates for d1bdc__.
(The format of our PDB-style files is described here.)

Timeline for d1bdc__: