Lineage for d1bdc__ (1bdc -)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 150804Fold a.8: Bacterial immunoglobulin/albumin-binding domains [46996] (1 superfamily)
  4. 150805Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) (S)
  5. 150806Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (1 protein)
  6. 150807Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 150808Species Staphylococcus aureus [TaxId:1280] [47000] (9 PDB entries)
  8. 150817Domain d1bdc__: 1bdc - [16350]

Details for d1bdc__

PDB Entry: 1bdc (more details)

PDB Description: staphylococcus aureus protein a, immunoglobulin-binding b domain, nmr, 10 structures

SCOP Domain Sequences for d1bdc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdc__ a.8.1.1 (-) Immunoglobulin-binding protein A modules {Staphylococcus aureus}
tadnkfnkeqqnafyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapka

SCOP Domain Coordinates for d1bdc__:

Click to download the PDB-style file with coordinates for d1bdc__.
(The format of our PDB-style files is described here.)

Timeline for d1bdc__: