Lineage for d2cx7b_ (2cx7 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037130Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 1037131Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 1037132Family d.106.1.1: Sterol carrier protein, SCP [55719] (4 proteins)
    Pfam PF02036
  6. 1037146Protein automated matches [190237] (2 species)
    not a true protein
  7. 1037149Species Thermus thermophilus [TaxId:274] [187580] (1 PDB entry)
  8. 1037151Domain d2cx7b_: 2cx7 B: [163490]
    automated match to d1wfra_
    complexed with po4

Details for d2cx7b_

PDB Entry: 2cx7 (more details), 1.75 Å

PDB Description: Crystal structure of sterol carrier protein 2
PDB Compounds: (B:) Sterol carrier protein 2

SCOPe Domain Sequences for d2cx7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cx7b_ d.106.1.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
melfteawaqaycrklneseayrkaastwegslalavrpdpkagfpkgvavvldlwhgac
rgakavegeaeadfvieadlatwqevlegrleplsalmrgllelkkgtiaalapyaqaaq
elvkvareva

SCOPe Domain Coordinates for d2cx7b_:

Click to download the PDB-style file with coordinates for d2cx7b_.
(The format of our PDB-style files is described here.)

Timeline for d2cx7b_: