SCOPe 2.08: Domain d2cx7b_: 2cx7 B:

Lineage for d2cx7b_ (2cx7 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.106: SCP-like [55717] (1 superfamily)
   alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145

4. Superfamily d.106.1: SCP-like [55718] (5 families)

5. Family d.106.1.1: Sterol carrier protein, SCP [55719] (4 proteins)
   Pfam PF02036

6. Protein automated matches [190237] (3 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [187580] (1 PDB entry)

8. Domain d2cx7b_: 2cx7 B: [163490]
   automated match to d1wfra_
   complexed with po4

Details for d2cx7b_

PDB Entry: 2cx7, 1.75 Å

PDB Description: Crystal structure of sterol carrier protein 2

PDB Compounds: (B:) Sterol carrier protein 2

SCOPe Domain Sequences for d2cx7b_:

Sequence; same for both SEQRES and ATOM records:

>d2cx7b_ d.106.1.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
melfteawaqaycrklneseayrkaastwegslalavrpdpkagfpkgvavvldlwhgac
rgakavegeaeadfvieadlatwqevlegrleplsalmrgllelkkgtiaalapyaqaaq
elvkvareva

Timeline for d2cx7b_:

• d2cx7b_ first appeared in SCOPe 2.01
  
• d2cx7b_ appears in SCOPe 2.07