SCOPe 2.03: Domain d2cx7a_: 2cx7 A:

Lineage for d2cx7a_ (2cx7 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.106: SCP-like [55717] (1 superfamily)
   alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145

4. Superfamily d.106.1: SCP-like [55718] (5 families)

5. Family d.106.1.1: Sterol carrier protein, SCP [55719] (4 proteins)
   Pfam PF02036

6. Protein automated matches [190237] (2 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [187580] (1 PDB entry)

8. Domain d2cx7a_: 2cx7 A: [163489]
   automated match to d1wfra_
   complexed with po4

Details for d2cx7a_

PDB Entry: 2cx7, 1.75 Å

PDB Description: Crystal structure of sterol carrier protein 2

PDB Compounds: (A:) Sterol carrier protein 2

SCOPe Domain Sequences for d2cx7a_:

Sequence; same for both SEQRES and ATOM records:

>d2cx7a_ d.106.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
elfteawaqaycrklneseayrkaastwegslalavrpdpkagfpkgvavvldlwhgacr
gakavegeaeadfvieadlatwqevlegrleplsalmrgllelkkgtiaalapyaqaaqe
lvkvareva

Timeline for d2cx7a_:

• d2cx7a_ first appeared in SCOPe 2.01
  
• d2cx7a_ appears in SCOPe 2.02
  
• d2cx7a_ appears in SCOPe 2.04
  
• d2cx7a_ appears in the current release, SCOPe 2.08