SCOPe 2.08: Domain d2cwsa1: 2cws A:83-308

Lineage for d2cwsa1 (2cws A:83-308)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Sphingomonas sp. [TaxId:90322] [187577] (4 PDB entries)

8. Domain d2cwsa1: 2cws A:83-308 [163484]
   Other proteins in same PDB: d2cwsa2
   automated match to d1vava_
   complexed with gol, so4

Details for d2cwsa1

PDB Entry: 2cws, 1 Å

PDB Description: Crystal structure at 1.0 A of alginate lyase A1-II', a member of polysaccharide lyase family-7

PDB Compounds: (A:) alginate lyase A1-II'

SCOPe Domain Sequences for d2cwsa1:

Sequence; same for both SEQRES and ATOM records:

>d2cwsa1 b.29.1.0 (A:83-308) automated matches {Sphingomonas sp. [TaxId: 90322]}
aapgknfdlshwklqlpdantteissanlglgytsqyfytdtdgamtfwapttggttans
syprselremldpsnskvnwgwqgthtmklsgktvqlpssgkiivaqihgimddgtnapp
lvkavfqdgqldmqvkqnsdgtgsdvhnyftgiklgdlynmeirvtdgvayvtmngdtrs
vdfvgkdagwknlkyyfkagnyvqdntstggsaiaklyslsvshsn

Timeline for d2cwsa1:

• d2cwsa1 first appeared in SCOPe 2.01, called d2cwsa_
  
• d2cwsa1 appears in SCOPe 2.07