Lineage for d2cwmd_ (2cwm D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2778984Species Canavalia maritima [TaxId:3825] [187574] (6 PDB entries)
  8. 2778999Domain d2cwmd_: 2cwm D: [163482]
    automated match to d1apna_
    complexed with ca, mn

Details for d2cwmd_

PDB Entry: 2cwm (more details), 1.95 Å

PDB Description: native crystal structure of no releasing inductive lectin from seeds of the canavalia maritima (conm)
PDB Compounds: (D:) lectin

SCOPe Domain Sequences for d2cwmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwmd_ b.29.1.1 (D:) automated matches {Canavalia maritima [TaxId: 3825]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d2cwmd_:

Click to download the PDB-style file with coordinates for d2cwmd_.
(The format of our PDB-style files is described here.)

Timeline for d2cwmd_: