| Class b: All beta proteins [48724] (174 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
| Family b.29.1.1: Legume lectins [49900] (5 proteins) |
| Protein automated matches [190035] (15 species) not a true protein |
| Species Canavalia maritima [TaxId:3825] [187574] (6 PDB entries) |
| Domain d2cwma_: 2cwm A: [163481] automated match to d1apna_ complexed with ca, mn |
PDB Entry: 2cwm (more details), 1.95 Å
SCOPe Domain Sequences for d2cwma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cwma_ b.29.1.1 (A:) automated matches {Canavalia maritima [TaxId: 3825]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan
Timeline for d2cwma_: