Lineage for d2cwdc_ (2cwd C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874828Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2874901Family c.44.1.0: automated matches [191415] (1 protein)
    not a true family
  6. 2874902Protein automated matches [190574] (20 species)
    not a true protein
  7. 2874966Species Thermus thermophilus HB8 [TaxId:300852] [187572] (1 PDB entry)
  8. 2874969Domain d2cwdc_: 2cwd C: [163479]
    automated match to d1bvha_
    complexed with mg

Details for d2cwdc_

PDB Entry: 2cwd (more details), 1.9 Å

PDB Description: Crystal Structure of TT1001 protein from Thermus thermophilus HB8
PDB Compounds: (C:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d2cwdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwdc_ c.44.1.0 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
pvrvlfvclgnicrspmaegifrkllkergledrfevdsagtgawhvgepmdprarrvle
eegayfphvarrltredvlaydhilvmdrenleevlrrfpeargkvrlvleelgggevqd
pyygdledfrevywtleaalqafldrhg

SCOPe Domain Coordinates for d2cwdc_:

Click to download the PDB-style file with coordinates for d2cwdc_.
(The format of our PDB-style files is described here.)

Timeline for d2cwdc_: