SCOPe 2.06: Domain d2cwdb_: 2cwd B:

Lineage for d2cwdb_ (2cwd B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (17 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187572] (1 PDB entry)

8. Domain d2cwdb_: 2cwd B: [163478]
   automated match to d1bvha_
   complexed with mg

Details for d2cwdb_

PDB Entry: 2cwd, 1.9 Å

PDB Description: Crystal Structure of TT1001 protein from Thermus thermophilus HB8

PDB Compounds: (B:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d2cwdb_:

Sequence; same for both SEQRES and ATOM records:

>d2cwdb_ c.44.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mdrpvrvlfvclgnicrspmaegifrkllkergledrfevdsagtgawhvgepmdprarr
vleeegayfphvarrltredvlaydhilvmdrenleevlrrfpeargkvrlvleelggge
vqdpyygdledfrevywtleaalqafldrhg

Timeline for d2cwdb_:

• d2cwdb_ first appeared in SCOPe 2.01
  
• d2cwdb_ appears in SCOPe 2.05
  
• d2cwdb_ appears in SCOPe 2.07
  
• d2cwdb_ appears in the current release, SCOPe 2.08