Lineage for d2cwda_ (2cwd A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130626Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2130627Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2130696Family c.44.1.0: automated matches [191415] (1 protein)
    not a true family
  6. 2130697Protein automated matches [190574] (17 species)
    not a true protein
  7. 2130757Species Thermus thermophilus HB8 [TaxId:300852] [187572] (1 PDB entry)
  8. 2130758Domain d2cwda_: 2cwd A: [163477]
    automated match to d1bvha_
    complexed with mg

Details for d2cwda_

PDB Entry: 2cwd (more details), 1.9 Å

PDB Description: Crystal Structure of TT1001 protein from Thermus thermophilus HB8
PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d2cwda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwda_ c.44.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
drpvrvlfvclgnicrspmaegifrkllkergledrfevdsagtgawhvgepmdprarrv
leeegayfphvarrltredvlaydhilvmdrenleevlrrfpeargkvrlvleelgggev
qdpyygdledfrevywtleaalqafldrhg

SCOPe Domain Coordinates for d2cwda_:

Click to download the PDB-style file with coordinates for d2cwda_.
(The format of our PDB-style files is described here.)

Timeline for d2cwda_: