SCOPe 2.05: Domain d2cwda_: 2cwd A:

Lineage for d2cwda_ (2cwd A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (15 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187572] (1 PDB entry)

8. Domain d2cwda_: 2cwd A: [163477]
   automated match to d1bvha_
   complexed with mg

Details for d2cwda_

PDB Entry: 2cwd, 1.9 Å

PDB Description: Crystal Structure of TT1001 protein from Thermus thermophilus HB8

PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d2cwda_:

Sequence; same for both SEQRES and ATOM records:

>d2cwda_ c.44.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
drpvrvlfvclgnicrspmaegifrkllkergledrfevdsagtgawhvgepmdprarrv
leeegayfphvarrltredvlaydhilvmdrenleevlrrfpeargkvrlvleelgggev
qdpyygdledfrevywtleaalqafldrhg

Timeline for d2cwda_:

• d2cwda_ first appeared in SCOPe 2.01
  
• d2cwda_ appears in SCOPe 2.04
  
• d2cwda_ appears in SCOPe 2.06
  
• d2cwda_ appears in the current release, SCOPe 2.08