Lineage for d2cvka_ (2cvk A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2135123Species Thermus thermophilus [TaxId:274] [187570] (1 PDB entry)
  8. 2135124Domain d2cvka_: 2cvk A: [163474]
    automated match to d1nw2a_

Details for d2cvka_

PDB Entry: 2cvk (more details), 2 Å

PDB Description: Crystal Structure of Thermus thermophilus Thioredoxin
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2cvka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvka_ c.47.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
kpievtdqnfdetlgqhplvlvdfwaewcapcrmiapileeiakeyegkllvakldvden
pktamryrvmsiptvilfkdgqpvevlvgaqpkrnyqakiekhlp

SCOPe Domain Coordinates for d2cvka_:

Click to download the PDB-style file with coordinates for d2cvka_.
(The format of our PDB-style files is described here.)

Timeline for d2cvka_: