SCOPe 2.05: Domain d1edla_: 1edl A:

Lineage for d1edla_ (1edl A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families)

5. Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
   automatically mapped to Pfam PF02216

6. Protein Immunoglobulin-binding protein A modules [46999] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [47000] (15 PDB entries)

8. Domain d1edla_: 1edl A: [16347]
   domain E

Details for d1edla_

PDB Entry: 1edl

PDB Description: staphylococcal protein a e-domain (-60), nmr, 22 structures

PDB Compounds: (A:) staphylococcal protein a

SCOPe Domain Sequences for d1edla_:

Sequence; same for both SEQRES and ATOM records:

>d1edla_ a.8.1.1 (A:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
aqhdeaqqnafyqvlnmpnlnadqrngfiqslkddpsqsanvlgeaqklndsqapk

Timeline for d1edla_:

• d1edla_ first appeared (with stable ids) in SCOP 1.55, called d1edl__
  
• d1edla_ appears in SCOPe 2.04
  
• d1edla_ appears in SCOPe 2.06
  
• d1edla_ appears in the current release, SCOPe 2.08