Class a: All alpha proteins [46456] (179 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (3 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) |
Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (1 protein) |
Protein Immunoglobulin-binding protein A modules [46999] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [47000] (11 PDB entries) |
Domain d1edl__: 1edl - [16347] domain E |
PDB Entry: 1edl (more details)
SCOP Domain Sequences for d1edl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1edl__ a.8.1.1 (-) Immunoglobulin-binding protein A modules {Staphylococcus aureus} aqhdeaqqnafyqvlnmpnlnadqrngfiqslkddpsqsanvlgeaqklndsqapk
Timeline for d1edl__: