Lineage for d1edl__ (1edl -)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 278744Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (3 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 278745Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) (S)
  5. 278746Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (1 protein)
  6. 278747Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 278748Species Staphylococcus aureus [TaxId:1280] [47000] (11 PDB entries)
  8. 278755Domain d1edl__: 1edl - [16347]
    domain E

Details for d1edl__

PDB Entry: 1edl (more details)

PDB Description: staphylococcal protein a e-domain (-60), nmr, 22 structures

SCOP Domain Sequences for d1edl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edl__ a.8.1.1 (-) Immunoglobulin-binding protein A modules {Staphylococcus aureus}
aqhdeaqqnafyqvlnmpnlnadqrngfiqslkddpsqsanvlgeaqklndsqapk

SCOP Domain Coordinates for d1edl__:

Click to download the PDB-style file with coordinates for d1edl__.
(The format of our PDB-style files is described here.)

Timeline for d1edl__: