Lineage for d2cqzf_ (2cqz F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736617Family a.211.1.1: HD domain [101340] (15 proteins)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2736699Protein automated matches [190349] (3 species)
    not a true protein
  7. 2736705Species Pyrococcus horikoshii OT3 [TaxId:70601] [187565] (1 PDB entry)
  8. 2736711Domain d2cqzf_: 2cqz F: [163467]
    automated match to d1xx7a_
    complexed with ni

Details for d2cqzf_

PDB Entry: 2cqz (more details), 2.6 Å

PDB Description: Crystal Structure of PH0347 protein from Pyrococcus horikoshii OT3
PDB Compounds: (F:) 177aa long hypothetical protein

SCOPe Domain Sequences for d2cqzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqzf_ a.211.1.1 (F:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
miekillvqtlkrlprmgwlikgvqepesiadhsfgvafitlvladvlekrgkridveka
lkmaivhdlaeaiitdiplsaqefvdkdkaealvfkkvfpefyelyreyqecsspeaqlv
riadkldmilqayqyelsgnknldefweaieeikrlelskyledilnsvgrlk

SCOPe Domain Coordinates for d2cqzf_:

Click to download the PDB-style file with coordinates for d2cqzf_.
(The format of our PDB-style files is described here.)

Timeline for d2cqzf_: