SCOPe 2.05: Domain d2cqze_: 2cqz E:

Lineage for d2cqze_ (2cqz E:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.1: HD domain [101340] (14 proteins)
   Pfam PF01966; metal dependent phosphohydrolases

6. Protein automated matches [190349] (2 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [187565] (1 PDB entry)

8. Domain d2cqze_: 2cqz E: [163466]
   automated match to d1xx7a_
   complexed with ni

Details for d2cqze_

PDB Entry: 2cqz, 2.6 Å

PDB Description: Crystal Structure of PH0347 protein from Pyrococcus horikoshii OT3

PDB Compounds: (E:) 177aa long hypothetical protein

SCOPe Domain Sequences for d2cqze_:

Sequence; same for both SEQRES and ATOM records:

>d2cqze_ a.211.1.1 (E:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
miekillvqtlkrlprmgwlikgvqepesiadhsfgvafitlvladvlekrgkridveka
lkmaivhdlaeaiitdiplsaqefvdkdkaealvfkkvfpefyelyreyqecsspeaqlv
riadkldmilqayqyelsgnknldefweaieeikrlelskyledilnsvgrlk

Timeline for d2cqze_:

• d2cqze_ first appeared in SCOPe 2.01
  
• d2cqze_ appears in SCOPe 2.04
  
• d2cqze_ appears in SCOPe 2.06
  
• d2cqze_ appears in the current release, SCOPe 2.08