Lineage for d2cqzd_ (2cqz D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1753307Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1753308Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1753309Family a.211.1.1: HD domain [101340] (14 proteins)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 1753383Protein automated matches [190349] (2 species)
    not a true protein
  7. 1753386Species Pyrococcus horikoshii [TaxId:70601] [187565] (1 PDB entry)
  8. 1753390Domain d2cqzd_: 2cqz D: [163465]
    automated match to d1xx7a_
    complexed with ni

Details for d2cqzd_

PDB Entry: 2cqz (more details), 2.6 Å

PDB Description: Crystal Structure of PH0347 protein from Pyrococcus horikoshii OT3
PDB Compounds: (D:) 177aa long hypothetical protein

SCOPe Domain Sequences for d2cqzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqzd_ a.211.1.1 (D:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
miekillvqtlkrlprmgwlikgvqepesiadhsfgvafitlvladvlekrgkridveka
lkmaivhdlaeaiitdiplsaqefvdkdkaealvfkkvfpefyelyreyqecsspeaqlv
riadkldmilqayqyelsgnknldefweaieeikrlelskyledilnsvgrlk

SCOPe Domain Coordinates for d2cqzd_:

Click to download the PDB-style file with coordinates for d2cqzd_.
(The format of our PDB-style files is described here.)

Timeline for d2cqzd_: