![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.1: HD domain [101340] (15 proteins) Pfam PF01966; metal dependent phosphohydrolases |
![]() | Protein automated matches [190349] (3 species) not a true protein |
![]() | Species Pyrococcus horikoshii OT3 [TaxId:70601] [187565] (1 PDB entry) |
![]() | Domain d2cqzd_: 2cqz D: [163465] automated match to d1xx7a_ complexed with ni |
PDB Entry: 2cqz (more details), 2.6 Å
SCOPe Domain Sequences for d2cqzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cqzd_ a.211.1.1 (D:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} miekillvqtlkrlprmgwlikgvqepesiadhsfgvafitlvladvlekrgkridveka lkmaivhdlaeaiitdiplsaqefvdkdkaealvfkkvfpefyelyreyqecsspeaqlv riadkldmilqayqyelsgnknldefweaieeikrlelskyledilnsvgrlk
Timeline for d2cqzd_: