| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
| Family a.211.1.1: HD domain [101340] (15 proteins) Pfam PF01966; metal dependent phosphohydrolases |
| Protein automated matches [190349] (3 species) not a true protein |
| Species Pyrococcus horikoshii OT3 [TaxId:70601] [187565] (1 PDB entry) |
| Domain d2cqzc_: 2cqz C: [163464] automated match to d1xx7a_ complexed with ni |
PDB Entry: 2cqz (more details), 2.6 Å
SCOPe Domain Sequences for d2cqzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cqzc_ a.211.1.1 (C:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
miekillvqtlkrlprmgwlikgvqepesiadhsfgvafitlvladvlekrgkridveka
lkmaivhdlaeaiitdiplsaqefvdkdkaealvfkkvfpefyelyreyqecsspeaqlv
riadkldmilqayqyelsgnknldefweaieeikrlelskyledilnsvgrlk
Timeline for d2cqzc_: