Lineage for d1edja_ (1edj A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309262Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2309263Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2309264Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 protein domains)
    automatically mapped to Pfam PF02216
  6. 2309265Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 2309266Species Staphylococcus aureus [TaxId:1280] [47000] (22 PDB entries)
  8. 2309349Domain d1edja_: 1edj A: [16346]
    domain E

Details for d1edja_

PDB Entry: 1edj (more details)

PDB Description: staphylococcal protein a e-domain (180), nmr, 20 structures
PDB Compounds: (A:) staphylococcal protein a

SCOPe Domain Sequences for d1edja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edja_ a.8.1.1 (A:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
aqhdeaqqnafyqvlnmpnlnadqrngfiqslkddpsqsanvlgeaqklndsqapk

SCOPe Domain Coordinates for d1edja_:

Click to download the PDB-style file with coordinates for d1edja_.
(The format of our PDB-style files is described here.)

Timeline for d1edja_: