Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2cn7a_ (2cn7 A:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. Protein automated matches [190041] (21 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187027] (14 PDB entries)
  8. Domain d2cn7a_: 2cn7 A: [163457]
    automated match to d1fhaa_
    complexed with ca, gol; mutant

Details for d2cn7a_

PDB Entry: 2cn7 (more details)
PDB Description: recombinant human h ferritin, k86q, e27d and e107d mutant
PDB Compounds: (A:) ferritin heavy chain

SCOP Domain Sequences for d2cn7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cn7a_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseaainrqinldlyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhldknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOP Domain Coordinates for d2cn7a_:

Click to download the PDB-style file with coordinates for d2cn7a_.
(The format of our PDB-style files is described here.)

Timeline for d2cn7a_:

d2cn7a_ appears in SCOP 1.75A


d2cn7a_
(click for larger image)


d2cn7a_ in context of chain

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu