Lineage for d2cn6a_ (2cn6 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702543Species Human (Homo sapiens) [TaxId:9606] [187027] (13 PDB entries)
  8. 2702565Domain d2cn6a_: 2cn6 A: [163456]
    automated match to d1fhaa_
    complexed with ca, gol, zn; mutant

Details for d2cn6a_

PDB Entry: 2cn6 (more details), 2.2 Å

PDB Description: recombinant human h ferritin, k86q and e107d mutant, soaked with zn ions
PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d2cn6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cn6a_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhldknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOPe Domain Coordinates for d2cn6a_:

Click to download the PDB-style file with coordinates for d2cn6a_.
(The format of our PDB-style files is described here.)

Timeline for d2cn6a_: