SCOPe 2.06: Domain d2cmta_: 2cmt A:

Lineage for d2cmta_ (2cmt A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (18 species)
   not a true protein

7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [187342] (2 PDB entries)

8. Domain d2cmta_: 2cmt A: [163453]
   automated match to d2bitx1
   complexed with act

Details for d2cmta_

PDB Entry: 2cmt, 1.5 Å

PDB Description: the structure of reduced cyclophilin a from s. mansoni

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d2cmta_:

Sequence; same for both SEQRES and ATOM records:

>d2cmta_ b.62.1.1 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
nlprvffdirigngdagrivmelrsdivprtaenfralctgergfgyhnccfhrvipqfm
cqggdfvkgdgtggksiygrkfddenfqlrhegfgvlsmansgpntngsqfficttkcdw
ldgkhvvfgrvvdgqnvvkkmesvgsksgkvkepviisrcgeli

Timeline for d2cmta_:

• d2cmta_ first appeared in SCOPe 2.01
  
• d2cmta_ appears in SCOPe 2.05
  
• d2cmta_ appears in SCOPe 2.07
  
• d2cmta_ appears in the current release, SCOPe 2.08