Class b: All beta proteins [48724] (177 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein automated matches [190077] (18 species) not a true protein |
Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [187342] (2 PDB entries) |
Domain d2cmta_: 2cmt A: [163453] automated match to d2bitx1 complexed with act |
PDB Entry: 2cmt (more details), 1.5 Å
SCOPe Domain Sequences for d2cmta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cmta_ b.62.1.1 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} nlprvffdirigngdagrivmelrsdivprtaenfralctgergfgyhnccfhrvipqfm cqggdfvkgdgtggksiygrkfddenfqlrhegfgvlsmansgpntngsqfficttkcdw ldgkhvvfgrvvdgqnvvkkmesvgsksgkvkepviisrcgeli
Timeline for d2cmta_: