SCOPe 2.05: Domain d2cmlc_: 2cml C:

Lineage for d2cmlc_ (2cml C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)

6. Protein Influenza neuraminidase [50943] (2 species)

7. Species Influenza A virus, different strains [TaxId:11320] [50944] (62 PDB entries)
   Uniprot P03472 84-470

8. Domain d2cmlc_: 2cml C: [163450]
   automated match to d5nn9a_
   complexed with bma, ca, man, nag, zmr

Details for d2cmlc_

PDB Entry: 2cml, 2.15 Å

PDB Description: structure of neuraminidase from english duck subtype n6 complexed with 30 mm zanamivir, crystal soaked for 3 hours at 291 k.

PDB Compounds: (C:) Neuraminidase

SCOPe Domain Sequences for d2cmlc_:

Sequence; same for both SEQRES and ATOM records:

>d2cmlc_ b.68.1.1 (C:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
snsivalcgskkrlgswswhdgaeiiyfe

Timeline for d2cmlc_:

• d2cmlc_ first appeared in SCOPe 2.01
  
• d2cmlc_ appears in SCOPe 2.04
  
• d2cmlc_ appears in SCOPe 2.06
  
• d2cmlc_ appears in the current release, SCOPe 2.08