| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) ![]() |
| Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins) automatically mapped to Pfam PF02216 |
| Protein Immunoglobulin-binding protein A modules [46999] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [47000] (14 PDB entries) |
| Domain d1fc2c_: 1fc2 C: [16345] Other proteins in same PDB: d1fc2d1, d1fc2d2 domain B, incomplete complexed with so4 |
PDB Entry: 1fc2 (more details), 2.8 Å
SCOPe Domain Sequences for d1fc2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fc2c_ a.8.1.1 (C:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
fnkeqqnafyeilhlpnlneeqrngfiqslkddpsqsanllaea
Timeline for d1fc2c_: