SCOP 1.71: Domain d1fc2c_: 1fc2 C:

Lineage for d1fc2c_ (1fc2 C:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (8 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families)

5. Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (1 protein)

6. Protein Immunoglobulin-binding protein A modules [46999] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [47000] (13 PDB entries)

8. Domain d1fc2c_: 1fc2 C: [16345]
   Other proteins in same PDB: d1fc2d1, d1fc2d2
   domain B, incomplete
   complexed with fuc, gal, man, nag, so4

Details for d1fc2c_

PDB Entry: 1fc2, 2.8 Å

PDB Description: crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution

SCOP Domain Sequences for d1fc2c_:

Sequence; same for both SEQRES and ATOM records:

>d1fc2c_ a.8.1.1 (C:) Immunoglobulin-binding protein A modules {Staphylococcus aureus}
fnkeqqnafyeilhlpnlneeqrngfiqslkddpsqsanllaea

Timeline for d1fc2c_:

• d1fc2c_ first appeared (with stable ids) in SCOP 1.55
  
• d1fc2c_ appears in SCOP 1.69
  
• d1fc2c_ appears in SCOP 1.73
  
• d1fc2c_ appears in the current release, SCOPe 2.08