![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (34 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187027] (13 PDB entries) |
![]() | Domain d2clua_: 2clu A: [163445] automated match to d1fhaa_ complexed with ca, gol, zn; mutant |
PDB Entry: 2clu (more details), 2.1 Å
SCOPe Domain Sequences for d2clua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2clua_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere haeklmklqnqrggriflqdiqkpdcddwesglnamecalhldknvnqsllelhklatdk ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg
Timeline for d2clua_: