Lineage for d2cldx_ (2cld X:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846955Protein automated matches [190047] (27 species)
    not a true protein
  7. 1847028Species Human (Homo sapiens) [TaxId:9606] [186768] (145 PDB entries)
  8. 1847030Domain d2cldx_: 2cld X: [163442]
    automated match to d1aa9a_
    complexed with gdp, mg

Details for d2cldx_

PDB Entry: 2cld (more details), 1.22 Å

PDB Description: crystal structure analysis of a fluorescent form of h-ras p21 in complex with gdp (2)
PDB Compounds: (X:) gtpase hras

SCOPe Domain Sequences for d2cldx_:

Sequence, based on SEQRES records: (download)

>d2cldx_ c.37.1.8 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnksdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Sequence, based on observed residues (ATOM records): (download)

>d2cldx_ c.37.1.8 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdptiedsyrkqvvidgetclldildtagqee
ysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnksdlaar
tvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d2cldx_:

Click to download the PDB-style file with coordinates for d2cldx_.
(The format of our PDB-style files is described here.)

Timeline for d2cldx_: