Lineage for d2cl8b1 (2cl8 B:117-244)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (19 species)
    not a true protein
  7. 2559977Species Mouse (Mus musculus) [TaxId:10090] [187331] (27 PDB entries)
  8. 2560022Domain d2cl8b1: 2cl8 B:117-244 [163440]
    Other proteins in same PDB: d2cl8a2, d2cl8b2
    automated match to d1ypqa1
    complexed with bgc, ca, cl

Details for d2cl8b1

PDB Entry: 2cl8 (more details), 2.8 Å

PDB Description: dectin-1 in complex with beta-glucan
PDB Compounds: (B:) dectin-1

SCOPe Domain Sequences for d2cl8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cl8b1 d.169.1.0 (B:117-244) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtsshrin
afwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqicntss
ysicekel

SCOPe Domain Coordinates for d2cl8b1:

Click to download the PDB-style file with coordinates for d2cl8b1.
(The format of our PDB-style files is described here.)

Timeline for d2cl8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cl8b2