Lineage for d1deeh_ (1dee H:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 352714Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (6 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 352715Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) (S)
  5. 352716Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (1 protein)
  6. 352717Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 352718Species Staphylococcus aureus [TaxId:1280] [47000] (13 PDB entries)
  8. 352722Domain d1deeh_: 1dee H: [16344]
    Other proteins in same PDB: d1deea1, d1deea2, d1deeb1, d1deeb2, d1deec1, d1deec2, d1deed1, d1deed2, d1deee1, d1deee2, d1deef1, d1deef2
    domain D

Details for d1deeh_

PDB Entry: 1dee (more details), 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab

SCOP Domain Sequences for d1deeh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deeh_ a.8.1.1 (H:) Immunoglobulin-binding protein A modules {Staphylococcus aureus}
fnkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqapk

SCOP Domain Coordinates for d1deeh_:

Click to download the PDB-style file with coordinates for d1deeh_.
(The format of our PDB-style files is described here.)

Timeline for d1deeh_: