SCOPe 2.04: Domain d2cl8a_: 2cl8 A:

Lineage for d2cl8a_ (2cl8 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (17 PDB entries)

8. Domain d2cl8a_: 2cl8 A: [163439]
   automated match to d1ypqa1
   complexed with ca, cl

Details for d2cl8a_

PDB Entry: 2cl8, 2.8 Å

PDB Description: dectin-1 in complex with beta-glucan

PDB Compounds: (A:) dectin-1

SCOPe Domain Sequences for d2cl8a_:

Sequence; same for both SEQRES and ATOM records:

>d2cl8a_ d.169.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtsshrin
afwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqicntss
ysicekelk

Timeline for d2cl8a_:

• d2cl8a_ first appeared in SCOPe 2.01
  
• d2cl8a_ appears in SCOPe 2.03
  
• d2cl8a_ appears in SCOPe 2.05
  
• d2cl8a_ appears in the current release, SCOPe 2.08, called d2cl8a1