Lineage for d2cl7x_ (2cl7 X:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868119Domain d2cl7x_: 2cl7 X: [163438]
    automated match to d1aa9a_
    complexed with gtp, mg, xy2

Details for d2cl7x_

PDB Entry: 2cl7 (more details), 1.25 Å

PDB Description: crystal structure analysis of a fluorescent form of h-ras p21 in complex with gtp
PDB Compounds: (X:) gtpase hras

SCOPe Domain Sequences for d2cl7x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cl7x_ c.37.1.8 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdecdptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnksdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d2cl7x_:

Click to download the PDB-style file with coordinates for d2cl7x_.
(The format of our PDB-style files is described here.)

Timeline for d2cl7x_: