Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186768] (124 PDB entries) |
Domain d2cl0x_: 2cl0 X: [163435] automated match to d1aa9a_ complexed with gnp, mg, trs, xy2 |
PDB Entry: 2cl0 (more details), 1.8 Å
SCOPe Domain Sequences for d2cl0x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cl0x_ c.37.1.8 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgaggvgksaltiqliqnhfvdecdptiedsyrkqvvidgetclldildtag qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnksdl aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
Timeline for d2cl0x_: