Lineage for d2cksb_ (2cks B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095970Species Thermobifida fusca [TaxId:2021] [187554] (2 PDB entries)
  8. 2095972Domain d2cksb_: 2cks B: [163434]
    automated match to d1lf1a_
    complexed with ben, na, zn

Details for d2cksb_

PDB Entry: 2cks (more details), 1.6 Å

PDB Description: x-ray crystal structure of the catalytic domain of thermobifida fusca endoglucanase cel5a (e5)
PDB Compounds: (B:) endoglucanase e-5

SCOPe Domain Sequences for d2cksb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cksb_ c.1.8.0 (B:) automated matches {Thermobifida fusca [TaxId: 2021]}
tgtpverygkvqvcgtqlcdehgnpvqlrgmsthgiqwfdhcltdssldalaydwkadii
rlsmyiqedgyetnprgftdrmhqlidmatarglyvivdwhiltpgdphynldraktffa
eiaqrhasktnvlyeianepngvswasiksyaeevipvirqrdpdsviivgtrgwsslgv
segsgpaeiaanpvnasnimyafhfyaashrdnylnalreaselfpvfvtefgtetytgd
gandfqmadryidlmaerkigwtkwnysddfrsgavfqpgtcasggpwsgsslkasgqwv
rsklqs

SCOPe Domain Coordinates for d2cksb_:

Click to download the PDB-style file with coordinates for d2cksb_.
(The format of our PDB-style files is described here.)

Timeline for d2cksb_: