SCOPe 2.07: Domain d2ckrb_: 2ckr B:

Lineage for d2ckrb_ (2ckr B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (125 species)
   not a true protein

7. Species Thermobifida fusca [TaxId:2021] [187554] (2 PDB entries)

8. Domain d2ckrb_: 2ckr B: [163432]
   automated match to d1lf1a_
   complexed with ben, na, pg4, zn

Details for d2ckrb_

PDB Entry: 2ckr, 1.77 Å

PDB Description: x-ray crystal structure of the catalytic domain of thermobifida fusca endoglucanase cel5a (e5) e355q in complex with cellotetraose

PDB Compounds: (B:) endoglucanase e-5

SCOPe Domain Sequences for d2ckrb_:

Sequence; same for both SEQRES and ATOM records:

>d2ckrb_ c.1.8.0 (B:) automated matches {Thermobifida fusca [TaxId: 2021]}
gtpverygkvqvcgtqlcdehgnpvqlrgmsthgiqwfdhcltdssldalaydwkadiir
lsmyiqedgyetnprgftdrmhqlidmatarglyvivdwhiltpgdphynldraktffae
iaqrhasktnvlyeianepngvswasiksyaeevipvirqrdpdsviivgtrgwsslgvs
egsgpaeiaanpvnasnimyafhfyaashrdnylnalreaselfpvfvtqfgtetytgdg
andfqmadryidlmaerkigwtkwnysddfrsgavfqpgtcasggpwsgsslkasgqwvr
sklqs

Timeline for d2ckrb_:

• d2ckrb_ first appeared in SCOPe 2.01
  
• d2ckrb_ appears in SCOPe 2.06
  
• d2ckrb_ appears in the current release, SCOPe 2.08