![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) ![]() |
![]() | Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins) automatically mapped to Pfam PF02216 |
![]() | Protein Immunoglobulin-binding protein A modules [46999] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [47000] (15 PDB entries) |
![]() | Domain d1deeg_: 1dee G: [16343] Other proteins in same PDB: d1deea1, d1deea2, d1deeb1, d1deeb2, d1deec1, d1deec2, d1deed1, d1deed2, d1deee1, d1deee2, d1deef1, d1deef2 domain D |
PDB Entry: 1dee (more details), 2.7 Å
SCOPe Domain Sequences for d1deeg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1deeg_ a.8.1.1 (G:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]} dqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqapk
Timeline for d1deeg_: