Lineage for d1deeg_ (1dee G:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1903Fold a.8: Bacterial immunoglobulin/albumin-binding domains [46996] (1 superfamily)
  4. 1904Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) (S)
  5. 1905Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (1 protein)
  6. 1906Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 1907Species Staphylococcus aureus [TaxId:1280] [47000] (9 PDB entries)
  8. 1908Domain d1deeg_: 1dee G: [16343]
    Other proteins in same PDB: d1deea1, d1deea2, d1deeb1, d1deeb2, d1deec1, d1deec2, d1deed1, d1deed2, d1deee1, d1deee2, d1deef1, d1deef2

Details for d1deeg_

PDB Entry: 1dee (more details), 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab

SCOP Domain Sequences for d1deeg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deeg_ a.8.1.1 (G:) Immunoglobulin-binding protein A modules {Staphylococcus aureus}
dqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqapk

SCOP Domain Coordinates for d1deeg_:

Click to download the PDB-style file with coordinates for d1deeg_.
(The format of our PDB-style files is described here.)

Timeline for d1deeg_: