Lineage for d2ckfd_ (2ckf D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1405093Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1405776Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1405777Protein automated matches [190205] (13 species)
    not a true protein
  7. 1405823Species Sphingomonas sp. [TaxId:279135] [187555] (1 PDB entry)
  8. 1405825Domain d2ckfd_: 2ckf D: [163427]
    Other proteins in same PDB: d2ckfa1, d2ckfa2, d2ckfc1, d2ckfc2, d2ckfe1, d2ckfe2
    automated match to d1ulid_
    complexed with fe, fes

Details for d2ckfd_

PDB Entry: 2ckf (more details), 1.85 Å

PDB Description: crystal structure of the terminal component of the pah-hydroxylating dioxygenase from sphingomonas sp chy-1
PDB Compounds: (D:) ring-hydroxylating dioxygenase beta subunit

SCOPe Domain Sequences for d2ckfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckfd_ d.17.4.0 (D:) automated matches {Sphingomonas sp. [TaxId: 279135]}
qvpvtpdvhyaveahyraevrllqtgqyrewlhgmvaedihywmpiyeqrfvrdrrpdpt
pddaaiynddfeelkqrverlysgqvwmedppskiryfvsnveafeaengeldvlsnilv
yrnrrqtevtvhtlgredklrqdgngfkvfrrklildarvtqdknlyffc

SCOPe Domain Coordinates for d2ckfd_:

Click to download the PDB-style file with coordinates for d2ckfd_.
(The format of our PDB-style files is described here.)

Timeline for d2ckfd_: